PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G36680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 563aa    MW: 58735.4 Da    PI: 5.8392
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G36680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-15212260148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd +l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
  ORUFI02G36680.1 212 KGPWSPEEDAKLKAYIEENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 260
                      79*********************************************97 PP

2Myb_DNA-binding38.13.6e-12267309246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  ORUFI02G36680.1 267 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 309
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.093207260IPR017930Myb domain
SuperFamilySSF466891.05E-25209307IPR009057Homeodomain-like
SMARTSM007173.7E-12211262IPR001005SANT/Myb domain
PfamPF002491.5E-14212260IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-23213267IPR009057Homeodomain-like
CDDcd001677.93E-9214260No hitNo description
PROSITE profilePS5129421.924261315IPR017930Myb domain
SMARTSM007172.9E-10265313IPR001005SANT/Myb domain
PfamPF002498.0E-11267309IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-22268315IPR009057Homeodomain-like
CDDcd001671.18E-6269309No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MAAAAARDDD LGNDDLDDDR SNPRRQSGGR TAGPIRQGLH GDIGLQMTAA MAGDDANDGG  60
HGWRRWLSTA AVAAVLLSLG DGGDDDKATE GIRGSSAGMY TDKRSVSEDT HLYPSTKPTI  120
KPARPQPQMH PLTAAAKHAI TIPPPPPPAA AASYTSSPSS GTSDPSVLDL SSAEIDDDGD  180
GDDDRAEQQE IKNSKELVMG RAPCCDKASV KKGPWSPEED AKLKAYIEEN GTGGNWIALP  240
QKIGLKRCGK SCRLRWLNYL RPNIKHGDFT EEEEHIICSL YISIGSRWSI IAAQLPGRTD  300
NDIKNYWNTK LKKKLLGKRA PSRRARANQD HCGLAGSAAA AMCGGVGTAA AAAAPHQALS  360
SSALERIQLH MRLQGLYNSA FGCTTTSSNG GGVGVAPPQW PKLEALLPSR PLPAVQPTDA  420
VVATVQHPHH LVVGGHTLAT AAAAAATTSE AFQAAEHLDP AAATGSNYMP GVAGVEMTSS  480
SSMAGGGGFV AGYGLHDELY DFLFKCESIG GAQGGIIPSS LPELQCPDGS AIIGADEKFS  540
TWTSSSCDYG SGGAGDYVLG YDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-242123157108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040570.0AP004057.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1316_E06.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624187.10.0PREDICTED: uncharacterized protein LOC4330950
TrEMBLA0A0E0NLW10.0A0A0E0NLW1_ORYRU; Uncharacterized protein
STRINGLOC_Os02g54520.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-79myb domain protein 36